Anti-NIPAL2 antibody
| Name | Anti-NIPAL2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81362 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Rat, Rabbit |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids AAVAPAGPGDSASAALDELSLNFTYGAPGAGNGSLSGDWYRRNQIHLFGV ) of Human NIPAL2 |
| Description | Rabbit Polyclonal |
| Gene | NIPAL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-NIPAL2 antibody (ab81362) at 1 µg/ml + placenta lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution