Anti-NKAIN4 antibody
| Name | Anti-NKAIN4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87293 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Zebrafish |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 159-208 (LGFVCGCQVVSVFTDEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLP A) of Human NKAIN4 (NP_690603) |
| Description | Rabbit Polyclonal |
| Gene | NKAIN4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-NKAIN4 antibody (ab87293) at 1 µg/ml + MCF7 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution