Anti-NKAIN4 antibody
| Name | Anti-NKAIN4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87299 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 2-51 (GSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILG L) of Human NKAIN4 (NP_690603) |
| Description | Rabbit Polyclonal |
| Gene | NKAIN4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-NKAIN4 antibody (ab87299) at 1 µg/ml + HepG2 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution