Anti-NME4 antibody
| Name | Anti-NME4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98198 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to internal sequence amino acids 107-156 (VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDS V) of Human NME4 (NP 005000) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | NME4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-NME4 antibody (ab98198) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution