Name | Anti-NME4 antibody |
---|---|
Supplier | Abcam |
Catalog | ab98198 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
Antigen | Synthetic peptide corresponding to internal sequence amino acids 107-156 (VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDS V) of Human NME4 (NP 005000) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | NME4 |
Conjugate | Unconjugated |
Supplier Page | Shop |