Anti-NOL6 antibody
| Name | Anti-NOL6 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83967 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Yeast |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 35-84 (SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLL R) of Human NOL6 (NP_075068) |
| Description | Rabbit Polyclonal |
| Gene | NOL6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-NOL6 antibody (ab83967) at 1 µg/ml + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution