Name | Anti-NOL6 antibody |
---|---|
Supplier | Abcam |
Catalog | ab83967 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Yeast |
Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 35-84 (SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLL R) of Human NOL6 (NP_075068) |
Description | Rabbit Polyclonal |
Gene | NOL6 |
Conjugate | Unconjugated |
Supplier Page | Shop |