Anti-Noto antibody
| Name | Anti-Noto antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102617 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Guinea Pig, Bovine, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 11-60 (VQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSL P) of Mouse Noto (NP_001007473) |
| Description | Rabbit Polyclonal |
| Gene | Noto |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Noto antibody (ab102617) at 1 µg/ml + Mouse brain lysate at 10 µg