| Name | Anti-NR2C2 antibody [H0107B] |
|---|---|
| Supplier | Abcam |
| Catalog | ab41954 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a |
| Clone | H0107B |
| Applications | IP WB ELISA IHC-F |
| Species Reactivities | Mouse, Rat, Human |
| Antigen | Baculovirus-expressed recombinant fragment: IQGSEPASGPLSVFTSLNKEKIVTDQQTGQ , corresponding to Internal sequence amino acids 23-52 of Human NR2C2 Run BLAST with Run BLAST with |
| Description | Mouse Monoclonal |
| Gene | NR2C2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |