Anti-NRBF2 antibody
| Name | Anti-NRBF2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab125315 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Horse, Chicken, Bovine, Cat, Dog, Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 5-54 ( EGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAH ) of Mouse NRBF2 (NM_001036293) |
| Description | Rabbit Polyclonal |
| Gene | NRBF2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-NRBF2 antibody (ab125315) at 1 µg/ml + Mouse pancreas lysate at 10 µg