Anti-NRBP2 antibody
| Name | Anti-NRBP2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94697 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 179-227 ( IQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASELV ) of Human NRBP2 (NP_848659) |
| Description | Rabbit Polyclonal |
| Gene | NRBP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-NRBP2 antibody (ab94697) at 1 µg/ml + placenta lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution