Name | Anti-Nucleotide binding protein like antibody - C-terminal |
---|---|
Supplier | Abcam |
Catalog | ab140153 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 263-312 ( AQTLGLEVLGDIPLHLNIREASDTGQPIVFSQPESDEAKAYLRIAVEVVR ) of Human Nucleotide binding protein like (NP_079428) |
Description | Rabbit Polyclonal |
Gene | NUBPL |
Conjugate | Unconjugated |
Supplier Page | Shop |