Anti-Nucleotide binding protein like antibody - C-terminal
| Name | Anti-Nucleotide binding protein like antibody - C-terminal |
|---|---|
| Supplier | Abcam |
| Catalog | ab140153 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 263-312 ( AQTLGLEVLGDIPLHLNIREASDTGQPIVFSQPESDEAKAYLRIAVEVVR ) of Human Nucleotide binding protein like (NP_079428) |
| Description | Rabbit Polyclonal |
| Gene | NUBPL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Nucleotide binding protein like antibody - C-terminal (ab140153) at 1 µg/ml + A549 cell lysate at 10 µg