Name | Anti-ODF3L1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab81513 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB ELISA |
Species Reactivities | Human, Guinea Pig |
Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 1-50 of Human ODF3L1 (NP_787077); MKLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPS Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | ODF3L1 |
Conjugate | Unconjugated |
Supplier Page | Shop |