Anti-ODF3L1 antibody
| Name | Anti-ODF3L1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81513 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Guinea Pig |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 1-50 of Human ODF3L1 (NP_787077); MKLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPS Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ODF3L1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ODF3L1 antibody (ab81513) at 1 µg/ml (in 5% skim milk / PBS buffer) + Placenta Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution