Anti-ODF4 antibody
| Name | Anti-ODF4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab89796 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 2-51 ( DAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLS ) of Human ODF4 (NP_694552) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ODF4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ODF4 antibody (ab89796) at 1 µg/ml + Human fetal thymus lysate at 10 µgSecondaryHRP anti rabbit IgG at 1/50000 dilution