Name | Anti-ODF4 antibody |
---|---|
Supplier | Abcam |
Catalog | ab89796 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 2-51 ( DAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLS ) of Human ODF4 (NP_694552) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | ODF4 |
Conjugate | Unconjugated |
Supplier Page | Shop |