Anti-ODR4 antibody
| Name | Anti-ODR4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab123089 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Mouse, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Human |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 275-324 (SGSVNLRGNVRCRAYIHSNRPKVKDAVQAVKRDILNTVADRCEILFEDL L) of Rat ODR4 according to XP_222746 |
| Description | Rabbit Polyclonal |
| Gene | C1orf27 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ODR4 antibody (ab123089) at 1 µg/ml + Rat brain lysate at 10 µg