Anti-OR1I1 antibody - C-terminal
| Name | Anti-OR1I1 antibody - C-terminal |
|---|---|
| Supplier | Abcam |
| Catalog | ab133929 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 306-355 ( GKVAVPCPRPEQLLDVYHVPGSLLAARDTEMHPIPYPGGVQSLAGNRDME ) of Human OR1I1 (NP_001004713, NM_001004713) |
| Description | Rabbit Polyclonal |
| Gene | OR1I1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-OR1I1 antibody - C-terminal (ab133929) at 1 µg/ml + Human fetal stomach lysate with 5% skimmed milk