Anti-OR52E2 antibody
| Name | Anti-OR52E2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab126570 |
| Prices | $443.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P |
| Species Reactivities | Human |
| Antigen | antigen sequence: RTKQIYKCVKKILLQEQGMEKEEYLIHTRF , corresponding to amino acids 296-325 of Human OR52E2 |
| Description | Rabbit Polyclonal |
| Gene | OR52E2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
ab126570 at a 1/10 dilution staining OR52E2 in paraffin embedded Human hippocampus tissue by immunohistochemistry.