Anti-ORP8 antibody

Name Anti-ORP8 antibody
Supplier Abcam
Catalog ab99069
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC-P
Species Reactivities Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog
Antigen Synthetic peptide corresponding to a region within internal amino acids 755-804 ( YSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKR ) of Human ORP8 (NP_001003712)
Description Rabbit Polyclonal
Gene OSBPL8
Conjugate Unconjugated
Supplier Page Shop

Product images