Name | Anti-ORP8 antibody |
---|---|
Supplier | Abcam |
Catalog | ab84178 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1-50 ( SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS ) of Human OSBPL8 (NP_001003712) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | OSBPL8 |
Conjugate | Unconjugated |
Supplier Page | Shop |