Anti-ORP8 antibody
| Name | Anti-ORP8 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84178 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1-50 ( SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS ) of Human OSBPL8 (NP_001003712) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | OSBPL8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ORP8 antibody (ab84178) at 1 µg/ml + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution