Name | Anti-OSGIN1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab90128 |
Prices | $376.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 144-193 ( PGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWK ) of Human OSGIN1 (NP_037502) |
Description | Rabbit Polyclonal |
Gene | OSGIN1 |
Conjugate | Unconjugated |
Supplier Page | Shop |