Anti-OSGIN1 antibody
| Name | Anti-OSGIN1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90128 |
| Prices | $376.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 144-193 ( PGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWK ) of Human OSGIN1 (NP_037502) |
| Description | Rabbit Polyclonal |
| Gene | OSGIN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-OSGIN1 antibody (ab90128) at 1 µg/ml (5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution