Anti-OVCA2 antibody
| Name | Anti-OVCA2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab125405 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Mouse, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Human, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 106-155 ( LDKLGPFDGLLGFSQGAALAAFVCALGQAGDPRFPLPRFIILVSGFCPRG ) of Rat OVCA2 (NP_001102506 |
| Description | Rabbit Polyclonal |
| Gene | OVCA2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-OVCA2 antibody (ab125405) at 1 µg/ml + Rat Lung Lysate