Anti-PAS1C1 antibody
| Name | Anti-PAS1C1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90129 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 324-373 ( PTVFPNRSPWCQNPYVSAHPYCPLIEPHNTSTAGGRLDRQPRSRSTRPNR ) of Human PAS1C1 (NP_689803) |
| Description | Rabbit Polyclonal |
| Gene | LMNTD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PAS1C1 antibody (ab90129) at 1 µg/ml (5% skim milk / PBS buffer) + Human fetal intestine lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution