Anti-PBLD antibody
| Name | Anti-PBLD antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84339 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide, corresponding to N a region within terminal amino acids 1-50 (KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFI R) of Human PBLD (NP_001028255) |
| Description | Rabbit Polyclonal |
| Gene | PBLD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PBLD antibody (ab84339) at 1 µg/ml + Human Fetal Liver Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1: 50,000