Anti-PDE4C antibody
| Name | Anti-PDE4C antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab128663 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Chicken, Bovine, Cat, Dog, Pig, Drosophila |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 563-612 ( RIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGFIDYIAHPLWETW ) of Human PDE4C |
| Description | Rabbit Polyclonal |
| Gene | PDE4C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PDE4C antibody (ab128663) at 1 µg/ml + Human fetal lung lysate at 10 µg