Anti-PDE7B antibody
| Name | Anti-PDE7B antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98094 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 251-300 (IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLH N) of Human PDE7B (NP_061818) |
| Description | Rabbit Polyclonal |
| Gene | PDE7B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PDE7B antibody (ab98094) at 1 µg/ml + MCF7 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG diluted between 1/50,000 - 1/100,000