Anti-PHACTR3 antibody
| Name | Anti-PHACTR3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81340 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 325-374 (QQIEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKL N) of Human PHACTR3 (NP_ 899069) |
| Description | Rabbit Polyclonal |
| Gene | PHACTR3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PHACTR3 antibody (ab81340) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysateSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution