Anti-Phosphoserine phosphatase antibody
| Name | Anti-Phosphoserine phosphatase antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98186 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Sheep, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 175-224, IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE , of Human Phosphoserine phosphatase (NP_004568) |
| Description | Rabbit Polyclonal |
| Gene | PSPH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Phosphoserine phosphatase antibody (ab98186) at 1 µg/ml (n 5% skim milk / PBS buffer) + Human Fetal Heart Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution