Name | Anti-Phosphoserine phosphatase antibody |
---|---|
Supplier | Abcam |
Catalog | ab98186 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Sheep, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 175-224, IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE , of Human Phosphoserine phosphatase (NP_004568) |
Description | Rabbit Polyclonal |
Gene | PSPH |
Conjugate | Unconjugated |
Supplier Page | Shop |