Anti-PON1 antibody
| Name | Anti-PON1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab26930 |
| Prices | $0.00 |
| Sizes | 100 µg |
| Host | Chicken |
| Clonality | Polyclonal |
| Isotype | IgY |
| Applications | WB ICC/IF ICC/IF |
| Species Reactivities | Human |
| Antigen | Fusion protein: MYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIV, corresponding to amino acids 125-170 of PON1 Run BLAST with Run BLAST with |
| Description | Chicken Polyclonal |
| Gene | PON1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PON1 antibody (ab26930) at 1/3000 dilution + E. coli derived proteinSecondaryGoat anti IgY HRP at 1/10000 dilutiondeveloped using the ECL technique