Anti-POU5F2 antibody
| Name | Anti-POU5F2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94900 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 72-121 ( FRGWIAPCRPRLGASEAGDWLRRPSEGALPGPYIALRSIPKLPPPEDISG ) of Human POU5F2 (NP_694948) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | POU5F2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-POU5F2 antibody (ab94900) at 1 µg/ml + THP-1 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution