Anti-PPIL2 antibody
| Name | Anti-PPIL2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98925 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 179-228 ( MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP ) of Human PPIL2 (NP_055152) |
| Description | Rabbit Polyclonal |
| Gene | PPIL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PPIL2 antibody (ab98925) at 1 µg/ml + COLO205 cell lysate at 10 µg