Anti-PPP1R15B antibody
| Name | Anti-PPP1R15B antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab113809 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 480-529 ( SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL ) of Human PPP1R15B (NP_116222) |
| Description | Rabbit Polyclonal |
| Gene | PPP1R15B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PPP1R15B antibody (ab113809) at 1 µg/ml + THP-1 cell lysate at 10 µg