Name | Anti-PPP2R5E antibody |
---|---|
Supplier | Abcam |
Catalog | ab113784 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 120-169 ( SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP ) of Mouse PPP2R5E (NP_036154) |
Description | Rabbit Polyclonal |
Gene | Ppp2r5e |
Conjugate | Unconjugated |
Supplier Page | Shop |