Anti-PPP2R5E antibody
| Name | Anti-PPP2R5E antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab113784 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 120-169 ( SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP ) of Mouse PPP2R5E (NP_036154) |
| Description | Rabbit Polyclonal |
| Gene | Ppp2r5e |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PPP2R5E antibody (ab113784) at 1 µg/ml + Mouse Spleen Lysate at 10 µg