Anti-PRAMEF10 antibody
| Name | Anti-PRAMEF10 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84688 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rabbit, Cat |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 395-444 (DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREV R) of Human PRAMEF10 (NP_001034450) |
| Description | Rabbit Polyclonal |
| Gene | PRAMEF10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PRAMEF10 antibody (ab84688) at 1 µg/ml + Fetal brain lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution