Anti-PRDM9 antibody
| Name | Anti-PRDM9 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85654 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Chimpanzee |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 432-481 (PGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP K) of Human PRDM9 (NP_064612) |
| Description | Rabbit Polyclonal |
| Gene | PRDM9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PRDM9 antibody (ab85654) at 1 µg/ml (in 5% skim milk / PBS buffer) + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
ab85654 staining PRDM9 in testis tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
ab85654 staining PRDM9 in Human testis tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) after Antigen retrieval using heat. Primary antibody diluted to 5 μg/ml.
ab85654 staining PRDM9 in Human placenta tissue by Immunohistochemistry (Paraffin-embedded sections). Primary antibody used at 5 μg/ml
