Anti-PRMT3 antibody
| Name | Anti-PRMT3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab91430 |
| Prices | $376.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IP |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1 - 50 ( MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPC ) of Human PRMT3 (NP_005779 |
| Description | Rabbit Polyclonal |
| Gene | PRMT3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
All lanes : Anti-PRMT3 antibody (ab91430) at 0.1 µg/mlLane 1 : HeLa cell lysate at 50 µgLane 2 : HeLa cell lysate at 15 µgLane 3 : HeLa cell lysate at 5 µgLane 4 : 293T cell lysate at 50 µgdeveloped using the ECL technique
SSA1 was immunoprecipitated from 1mg HeLa whole cell lysate using 10µg ab91430. 20% of the immunoprecipitate was loaded per lane, and probed with ab91430 at 1µg/ml (lane 1) or a control IgG (lane2). Detection: chemoluminescence with an exposure time of 30 seconds.