Name | Anti-PSTK antibody |
---|---|
Supplier | Abcam |
Catalog | ab89979 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 144 -193 (RPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ R) of Human PSTK (NP_699167) |
Description | Rabbit Polyclonal |
Gene | PSTK |
Conjugate | Unconjugated |
Supplier Page | Shop |