Anti-PSTK antibody
| Name | Anti-PSTK antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab89979 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 144 -193 (RPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ R) of Human PSTK (NP_699167) |
| Description | Rabbit Polyclonal |
| Gene | PSTK |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PSTK antibody (ab89979) at 1 µg/ml + THP-1 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution