Anti-PTGER3 antibody
| Name | Anti-PTGER3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94496 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 360-409 (MRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV Y) of Human Prostaglandin E Receptor EP3 ((NP_942011) |
| Description | Rabbit Polyclonal |
| Gene | PTGER3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PTGER3 antibody (ab94496) at 1 µg/ml + HT1080 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution