Anti-QPCTL antibody
| Name | Anti-QPCTL antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab80847 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Cat, Dog |
| Antigen | Synthetic peptide derived from within residues: TLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELF , corresponding to amino acids 215-264 of Human QPCTL Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | QPCTL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-QPCTL antibody (ab80847) at 1 µg/ml + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution