Name | Anti-RAB37 antibody |
---|---|
Supplier | Abcam |
Catalog | ab105189 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 143-192 (ERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQ A) of Human RAB37 according to NP_783865 |
Description | Rabbit Polyclonal |
Gene | RAB37 |
Conjugate | Unconjugated |
Supplier Page | Shop |