Anti-RAB37 antibody
| Name | Anti-RAB37 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab105189 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 143-192 (ERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQ A) of Human RAB37 according to NP_783865 |
| Description | Rabbit Polyclonal |
| Gene | RAB37 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RAB37 antibody (ab105189) at 1 µg/ml + RAB37 transfected 293T cell lysate at 10 µg