Anti-RAB39 antibody
| Name | Anti-RAB39 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab118952 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 ( METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF ) of Human RAB39 (NP_059986 |
| Description | Rabbit Polyclonal |
| Gene | RAB39A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RAB39 antibody (ab118952) at 1 µg/ml + HeLa Cell lysate at 10 µg