Name | Anti-RAB39 antibody |
---|---|
Supplier | Abcam |
Catalog | ab118952 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat |
Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 ( METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF ) of Human RAB39 (NP_059986 |
Description | Rabbit Polyclonal |
Gene | RAB39A |
Conjugate | Unconjugated |
Supplier Page | Shop |