Anti-RAB6C antibody
| Name | Anti-RAB6C antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab113838 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Yeast, Drosophila, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 118-167 ( DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF ) of Human RAB6C (NP_115520) |
| Description | Rabbit Polyclonal |
| Gene | RAB6C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RAB6C antibody (ab113838) at 1 µg/ml + HepG2 cell lysate at 10 µg