Anti-RALGDS antibody
| Name | Anti-RALGDS antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94786 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide from within N terminal amino acids 108-157 residues ( RYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSEDF ) of Human RALGDS (NP_001035827) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | RALGDS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RALGDS antibody (ab94786) at 1 µg/ml + HepG2 cell lysate at 10 µg with 5% skim milk / PBS bufferGel concentration: 6-18%SecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution