Anti-RASL10A antibody - N-terminal
| Name | Anti-RASL10A antibody - N-terminal |
|---|---|
| Supplier | Abcam |
| Catalog | ab130913 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Human, Rat, Rabbit, Horse, Guinea Pig, Bovine, Dog, Pig, Chimpanzee, Monkey, Ape, Hamster, Marmoset, Orangutan, Elephant |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 18-67 ( TAIIRQFLFGDYPERHRPTDSPCLYRPAVLLDGAVYDLSIRDGDVAGPGS ) of Mouse Rasl10a (NP_660251) |
| Description | Rabbit Polyclonal |
| Gene | RASL10A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RASL10A antibody - N-terminal (ab130913) at 1 µg/ml + Mouse Lung lysates