Name | Anti-RAVER2 antibody |
---|---|
Supplier | Abcam |
Catalog | ab94574 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Rabbit, Bovine, Cat |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 468-517 ( ITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQ ) of Human RAVER2 (NP_060681) |
Description | Rabbit Polyclonal |
Gene | RAVER2 |
Conjugate | Unconjugated |
Supplier Page | Shop |