Anti-RAVER2 antibody

Name Anti-RAVER2 antibody
Supplier Abcam
Catalog ab94574
Prices $370.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Rabbit, Bovine, Cat
Antigen Synthetic peptide corresponding to a region within internal amino acids 468-517 ( ITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQ ) of Human RAVER2 (NP_060681)
Description Rabbit Polyclonal
Gene RAVER2
Conjugate Unconjugated
Supplier Page Shop

Product images