Anti-RBM11 antibody
| Name | Anti-RBM11 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab106336 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 215-264 (SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNN R) of Human RBM11 (NP_658983) |
| Description | Rabbit Polyclonal |
| Gene | RBM11 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RBM11 antibody (ab106336) at 1 µg/ml + 721_B cell lysate at 10 µg