Name | Anti-RBP2 antibody |
---|---|
Supplier | Abcam |
Catalog | ab102840 |
Prices | $370.00 |
Sizes | 400 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide conjugated to KLH, corresponding to a region within internal sequence amino acids 63-92, VDFTVGVEFDEYTKSLDNRHVKALVTWEGD , of Human RBP2 Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | RBP2 |
Conjugate | Unconjugated |
Supplier Page | Shop |