Anti-RDH8 antibody
| Name | Anti-RDH8 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133738 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 111-160 (FDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASK F) of Human RDH8 (NP_056540) |
| Description | Rabbit Polyclonal |
| Gene | RDH8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RDH8 antibody (ab133738) at 1 µg/ml + A549 cell lysate at 10 µg