Anti-Retinoic Acid Receptor alpha antibody [H1920] - ChIP Grade
| Name | Anti-Retinoic Acid Receptor alpha antibody [H1920] - ChIP Grade |
|---|---|
| Supplier | Abcam |
| Catalog | ab41934 |
| Prices | $381.00 |
| Sizes | 100 µl |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 |
| Clone | H1920 |
| Applications | WB ELISA IP ChIP FC |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | Recombinant fragment: MASNSSSCPTPGGGHLNGYPVPPYAFFFPP , corresponding to amino acids 1-30 of Human Retinoic Acid Receptor alpha Run BLAST with Run BLAST with |
| Description | Mouse Monoclonal |
| Gene | RARA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Overlay histogram showing MCF7 cells stained with ab41934 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab41934, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells ) used under the same conditions. Acquisition of >5,000 events was performed.](http://www.bioprodhub.com/system/product_images/ab_products/2/sub_4/22193_Retinoic-Acid-Receptor-alpha-Primary-antibodies-ab41934-1.jpg)
Overlay histogram showing MCF7 cells stained with ab41934 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab41934, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells ) used under the same conditions. Acquisition of >5,000 events was performed.
Product References
Intronic elements in the Na+/I- symporter gene (NIS) interact with retinoic acid - Intronic elements in the Na+/I- symporter gene (NIS) interact with retinoic acid
Alotaibi H, Yaman E, Salvatore D, Di Dato V, Telkoparan P, Di Lauro R, Tazebay UH. Nucleic Acids Res. 2010 Jun;38(10):3172-85.
Functional involvement of RINF, retinoid-inducible nuclear factor (CXXC5), in - Functional involvement of RINF, retinoid-inducible nuclear factor (CXXC5), in
Pendino F, Nguyen E, Jonassen I, Dysvik B, Azouz A, Lanotte M, Segal-Bendirdjian E, Lillehaug JR. Blood. 2009 Apr 2;113(14):3172-81.