Anti-RFX2 antibody
| Name | Anti-RFX2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86170 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within amino acids 673-722 (DLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQG I) of Human RFX2 (NP_000626) |
| Description | Rabbit Polyclonal |
| Gene | RFX2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RFX2 antibody (ab86170) at 1 µg/ml + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution