Anti-RHBG antibody
| Name | Anti-RHBG antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102591 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine, Cat, Dog, Pig, Chimpanzee |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 ( RYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGFGFLMVFLQR ) of Human RHBG (NP_065140) |
| Description | Rabbit Polyclonal |
| Gene | RHBG |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RHBG antibody (ab102591) at 1 µg/ml + HT1080 Cell Lysate at 10 µg