Anti-RHOXF1 antibody
| Name | Anti-RHOXF1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108074 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 130-179 (VPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDC V ) of Human RHOXF1 (NP_644811) |
| Description | Rabbit Polyclonal |
| Gene | RHOXF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RHOXF1 antibody (ab108074) at 1 µg/ml + Jurkat cell lysate at 10 µg