Anti-RIBC1 antibody
| Name | Anti-RIBC1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102540 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 215-264 ( ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM ) of Human RIBC1 (NP_001026915) |
| Description | Rabbit Polyclonal |
| Gene | RIBC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RIBC1 antibody (ab102540) at 1 µg/ml + COLO205 cell lysate at 10 µg